PDCD4 polyclonal antibody
  • PDCD4 polyclonal antibody

PDCD4 polyclonal antibody

Ref: AB-PAB30214
PDCD4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PDCD4.
Información adicional
Size 100 uL
Gene Name PDCD4
Gene Alias H731|MGC33046|MGC33047
Gene Description programmed cell death 4 (neoplastic transformation inhibitor)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq VMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500 - 1:1000)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 230 - 330 of human PDCD4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 27250
Iso type IgG

Enviar uma mensagem


PDCD4 polyclonal antibody

PDCD4 polyclonal antibody