KCNAB3 polyclonal antibody
  • KCNAB3 polyclonal antibody

KCNAB3 polyclonal antibody

Ref: AB-PAB30160
KCNAB3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human KCNAB3.
Información adicional
Size 100 uL
Gene Name KCNAB3
Gene Alias AKR6A9|KCNA3.1B|KCNA3B|KV-BETA-3|MGC116886
Gene Description potassium voltage-gated channel, shaker-related subfamily, beta member 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq RNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTVAYEHGVNLFDTAEV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.65 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human KCNAB3.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 9196

Enviar uma mensagem


KCNAB3 polyclonal antibody

KCNAB3 polyclonal antibody