IKZF5 polyclonal antibody
  • IKZF5 polyclonal antibody

IKZF5 polyclonal antibody

Ref: AB-PAB30156
IKZF5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human IKZF5.
Información adicional
Size 100 uL
Gene Name IKZF5
Gene Alias DKFZp781B0249|FLJ22973|PEGASUS|ZNFN1A5
Gene Description IKAROS family zinc finger 5 (Pegasus)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq MGEKKPEPLDFVKDFQEYLTQQTHHVNMISGSVSGDKEAEALQGAGTDGD
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human IKZF5.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 64376

Enviar uma mensagem


IKZF5 polyclonal antibody

IKZF5 polyclonal antibody