IFIT3 polyclonal antibody
  • IFIT3 polyclonal antibody

IFIT3 polyclonal antibody

Ref: AB-PAB30151
IFIT3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human IFIT3.
Información adicional
Size 100 uL
Gene Name IFIT3
Gene Alias CIG-49|GARG-49|IFI60|IFIT4|IRG2|ISG60|RIG-G
Gene Description interferon-induced protein with tetratricopeptide repeats 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.25 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human IFIT3.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 3437

Enviar uma mensagem


IFIT3 polyclonal antibody

IFIT3 polyclonal antibody