IFI44L polyclonal antibody
  • IFI44L polyclonal antibody

IFI44L polyclonal antibody

Ref: AB-PAB30150
IFI44L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human IFI44L.
Información adicional
Size 100 uL
Gene Name IFI44L
Gene Alias C1orf29|GS3686
Gene Description interferon-induced protein 44-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (5 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human IFI44L.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 10964

Enviar uma mensagem


IFI44L polyclonal antibody

IFI44L polyclonal antibody