HTATIP2 polyclonal antibody
  • HTATIP2 polyclonal antibody

HTATIP2 polyclonal antibody

Ref: AB-PAB30148
HTATIP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human HTATIP2.
Información adicional
Size 100 uL
Gene Name HTATIP2
Gene Alias CC3|FLJ26963|SDR44U1|TIP30
Gene Description HIV-1 Tat interactive protein 2, 30kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq TGRVLLKEILEQGLFSKVTLIGRRKLTFDEEAYKNVNQEVVDFEKLDDYA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.5-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human HTATIP2.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 10553

Enviar uma mensagem


HTATIP2 polyclonal antibody

HTATIP2 polyclonal antibody