HSF2BP polyclonal antibody
  • HSF2BP polyclonal antibody

HSF2BP polyclonal antibody

Ref: AB-PAB30147
HSF2BP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human HSF2BP.
Información adicional
Size 100 uL
Gene Name HSF2BP
Gene Alias -
Gene Description heat shock transcription factor 2 binding protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq RHMGTKEEFVKVRKKDLERLTTEVMQIRDFLPRILNGEVLESFQKLKIVE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (1.25 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human HSF2BP.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 11077

Enviar uma mensagem


HSF2BP polyclonal antibody

HSF2BP polyclonal antibody