HOXC9 polyclonal antibody
  • HOXC9 polyclonal antibody

HOXC9 polyclonal antibody

Ref: AB-PAB30145
HOXC9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human HOXC9.
Información adicional
Size 100 uL
Gene Name HOXC9
Gene Alias HOX3|HOX3B
Gene Description homeobox C9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq DRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYT
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (2.5 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to internal region of human HOXC9.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 3225

Enviar uma mensagem


HOXC9 polyclonal antibody

HOXC9 polyclonal antibody