HOXB5 polyclonal antibody
  • HOXB5 polyclonal antibody

HOXB5 polyclonal antibody

Ref: AB-PAB30143
HOXB5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human HOXB5.
Información adicional
Size 100 uL
Gene Name HOXB5
Gene Alias HHO.C10|HOX2|HOX2A|HU-1|Hox2.1
Gene Description homeobox B5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,IHC-P
Immunogen Prot. Seq MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYN
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human HOXB5.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 3215

Enviar uma mensagem


HOXB5 polyclonal antibody

HOXB5 polyclonal antibody