HNRNPL polyclonal antibody
  • HNRNPL polyclonal antibody

HNRNPL polyclonal antibody

Ref: AB-PAB30142
HNRNPL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human HNRNPL.
Información adicional
Size 100 uL
Gene Name HNRNPL
Gene Alias FLJ35509|HNRPL|P/OKcl.14|hnRNP-L
Gene Description heterogeneous nuclear ribonucleoprotein L
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq RRRSGAMVKMAAAGGGGGGGRYYGGGSEGGRAPKRLKTDNAGDQHGGGGG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (1.25 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human HNRNPL.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 3191

Enviar uma mensagem


HNRNPL polyclonal antibody

HNRNPL polyclonal antibody