HNRNPA3 polyclonal antibody
  • HNRNPA3 polyclonal antibody

HNRNPA3 polyclonal antibody

Ref: AB-PAB30136
HNRNPA3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human HNRNPA3.
Información adicional
Size 100 uL
Gene Name HNRNPA3
Gene Alias 2610510D13Rik|D10S102|FBRNP|HNRPA3|MGC138232|MGC142030
Gene Description heterogeneous nuclear ribonucleoprotein A3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (1.25 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human HNRNPA3.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 220988

Enviar uma mensagem


HNRNPA3 polyclonal antibody

HNRNPA3 polyclonal antibody