HNRNPA1L2 polyclonal antibody
  • HNRNPA1L2 polyclonal antibody

HNRNPA1L2 polyclonal antibody

Ref: AB-PAB30135
HNRNPA1L2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human HNRNPA1L2.
Información adicional
Size 100 uL
Gene Name HNRNPA1L2
Gene Alias MGC102957
Gene Description heterogeneous nuclear ribonucleoprotein A1-like 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human HNRNPA1L2.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 144983

Enviar uma mensagem


HNRNPA1L2 polyclonal antibody

HNRNPA1L2 polyclonal antibody