HES7 polyclonal antibody
  • HES7 polyclonal antibody

HES7 polyclonal antibody

Ref: AB-PAB30130
HES7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human HES7.
Información adicional
Size 100 uL
Gene Name HES7
Gene Alias bHLHb37
Gene Description hairy and enhancer of split 7 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq VGYLRERSRVEPPGVPRSPVQDAKALASCYLSGFRECLLRLAAIAHDASP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to internal region of human HES7.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 84667

Enviar uma mensagem


HES7 polyclonal antibody

HES7 polyclonal antibody