GTF3C5 polyclonal antibody
  • GTF3C5 polyclonal antibody

GTF3C5 polyclonal antibody

Ref: AB-PAB30123
GTF3C5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human GTF3C5.
Información adicional
Size 100 uL
Gene Name GTF3C5
Gene Alias FLJ20857|TFIIIC63|TFIIICepsilon|TFiiiC2-63
Gene Description general transcription factor IIIC, polypeptide 5, 63kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq KVLMLRPEKEAFFHQELPLYIPPPIFSRLDAPVDYFYRPETQHREGYNNP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human GTF3C5.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 9328

Enviar uma mensagem


GTF3C5 polyclonal antibody

GTF3C5 polyclonal antibody