GSX2 polyclonal antibody View larger

Rabbit polyclonal antibody raised against synthetic peptide of human GSX2.

AB-PAB30113

New product

GSX2 polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name GSX2
Gene Alias GSH2
Gene Description GS homeobox 2
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq MSRSFYVDSLIIKDTSRPAPSLPEPHPGPDFFIPLGMPPPLVMSVSGPGC
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)<br>Western Blot<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human GSX2.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 170825

More info

Rabbit polyclonal antibody raised against synthetic peptide of human GSX2.

Enviar uma mensagem

Rabbit polyclonal antibody raised against synthetic peptide of human GSX2.

Rabbit polyclonal antibody raised against synthetic peptide of human GSX2.