GSX2 polyclonal antibody
  • GSX2 polyclonal antibody

GSX2 polyclonal antibody

Ref: AB-PAB30113
GSX2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human GSX2.
Información adicional
Size 100 uL
Gene Name GSX2
Gene Alias GSH2
Gene Description GS homeobox 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq MSRSFYVDSLIIKDTSRPAPSLPEPHPGPDFFIPLGMPPPLVMSVSGPGC
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Western Blot
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human GSX2.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 170825

Enviar uma mensagem


GSX2 polyclonal antibody

GSX2 polyclonal antibody