GSTM2 polyclonal antibody
  • GSTM2 polyclonal antibody

GSTM2 polyclonal antibody

Ref: AB-PAB30112
GSTM2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human GSTM2.
Información adicional
Size 100 uL
Gene Name GSTM2
Gene Alias GST4|GSTM|GSTM2-2|GTHMUS|MGC117303
Gene Description glutathione S-transferase mu 2 (muscle)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq TQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human GSTM2.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 2946

Enviar uma mensagem


GSTM2 polyclonal antibody

GSTM2 polyclonal antibody