GNAS polyclonal antibody
  • GNAS polyclonal antibody

GNAS polyclonal antibody

Ref: AB-PAB30105
GNAS polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human GNAS.
Información adicional
Size 100 uL
Gene Name GNAS
Gene Alias AHO|C20orf45|GNAS1|GPSA|GSA|GSP|MGC33735|NESP|PHP1A|PHP1B|POH|dJ309F20.1.1|dJ806M20.3.3
Gene Description GNAS complex locus
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human GNAS.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 2778

Enviar uma mensagem


GNAS polyclonal antibody

GNAS polyclonal antibody