GFI1B polyclonal antibody
  • GFI1B polyclonal antibody

GFI1B polyclonal antibody

Ref: AB-PAB30101
GFI1B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human GFI1B.
Información adicional
Size 100 uL
Gene Name GFI1B
Gene Alias -
Gene Description growth factor independent 1B transcription repressor
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq MPRSFLVKSKMAHTYHQPRVQEDEPLWPPALTPVPRDQAPSNSPVLSTLF
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human GFI1B.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 8328

Enviar uma mensagem


GFI1B polyclonal antibody

GFI1B polyclonal antibody