View larger
Rabbit polyclonal antibody raised against synthetic peptide of human GFI1B.
AB-PAB30101
New product
GFI1B polyclonal antibody
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Data sheet
| Size | 100 uL |
| Gene Name | GFI1B |
| Gene Alias | - |
| Gene Description | growth factor independent 1B transcription repressor |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,IHC-P |
| Immunogen Prot. Seq | MPRSFLVKSKMAHTYHQPRVQEDEPLWPPALTPVPRDQAPSNSPVLSTLF |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)<br>Western Blot (0.2-1 ug/mL)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | A synthetic peptide corresponding to N-terminus of human GFI1B. |
| Storage Buffer | In PBS (2% sucrose, 0.09% sodium azide). |
| Gene ID | 8328 |
More info
Rabbit polyclonal antibody raised against synthetic peptide of human GFI1B.