GCM1 polyclonal antibody
  • GCM1 polyclonal antibody

GCM1 polyclonal antibody

Ref: AB-PAB30098
GCM1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human GCM1.
Información adicional
Size 100 uL
Gene Name GCM1
Gene Alias GCMA|hGCMa
Gene Description glial cells missing homolog 1 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,IHC-P
Immunogen Prot. Seq MEPDDFDSEDKEILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human GCM1.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 8521

Enviar uma mensagem


GCM1 polyclonal antibody

GCM1 polyclonal antibody