GAS7 polyclonal antibody
  • GAS7 polyclonal antibody

GAS7 polyclonal antibody

Ref: AB-PAB30095
GAS7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human GAS7.
Información adicional
Size 100 uL
Gene Name GAS7
Gene Alias KIAA0394|MGC1348|MLL/GAS7
Gene Description growth arrest-specific 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq PGSHRSSLPPTVNGYHASGTPAHPPETAHMSVRKSTGDSQNLGSSSPSKK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (5 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human GAS7.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 8522

Enviar uma mensagem


GAS7 polyclonal antibody

GAS7 polyclonal antibody