GABRD polyclonal antibody
  • GABRD polyclonal antibody

GABRD polyclonal antibody

Ref: AB-PAB30091
GABRD polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human GABRD.
Información adicional
Size 100 uL
Gene Name GABRD
Gene Alias MGC45284
Gene Description gamma-aminobutyric acid (GABA) A receptor, delta
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,IHC-P
Immunogen Prot. Seq MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISWLPNLDGLIAG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Western Blot
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human GABRD.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 2563

Enviar uma mensagem


GABRD polyclonal antibody

GABRD polyclonal antibody