FTCD polyclonal antibody
  • FTCD polyclonal antibody

FTCD polyclonal antibody

Ref: AB-PAB30090
FTCD polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human FTCD.
Información adicional
Size 100 uL
Gene Name FTCD
Gene Alias LCHC1
Gene Description formiminotransferase cyclodeaminase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq FSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (1.25 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human FTCD.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 10841

Enviar uma mensagem


FTCD polyclonal antibody

FTCD polyclonal antibody