FOXQ1 polyclonal antibody
  • FOXQ1 polyclonal antibody

FOXQ1 polyclonal antibody

Ref: AB-PAB30087
FOXQ1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human FOXQ1.
Información adicional
Size 100 uL
Gene Name FOXQ1
Gene Alias HFH1
Gene Description forkhead box Q1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq MKLEVFVPRAAHGDKQGSDLEGAGGSDAPSPLSAAGDDSLGSDGDCAANS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human FOXQ1.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 94234

Enviar uma mensagem


FOXQ1 polyclonal antibody

FOXQ1 polyclonal antibody