FOXJ2 polyclonal antibody
  • FOXJ2 polyclonal antibody

FOXJ2 polyclonal antibody

Ref: AB-PAB30086
FOXJ2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human FOXJ2.
Información adicional
Size 100 uL
Gene Name FOXJ2
Gene Alias FHX
Gene Description forkhead box J2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq SLQSPTSIASYSQGTGSVDGGAVAAGASGRESAEGPPPLYNTNHDFKFSY
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (2 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to internal region of human FOXJ2.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 55810

Enviar uma mensagem


FOXJ2 polyclonal antibody

FOXJ2 polyclonal antibody