FOSL1 polyclonal antibody
  • FOSL1 polyclonal antibody

FOSL1 polyclonal antibody

Ref: AB-PAB30080
FOSL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human FOSL1.
Información adicional
Size 100 uL
Gene Name FOSL1
Gene Alias FRA|FRA1|fra-1
Gene Description FOS-like antigen 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq TDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to internal region of human FOSL1.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 8061

Enviar uma mensagem


FOSL1 polyclonal antibody

FOSL1 polyclonal antibody