FBP1 polyclonal antibody
  • FBP1 polyclonal antibody

FBP1 polyclonal antibody

Ref: AB-PAB30070
FBP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human FBP1.
Información adicional
Size 100 uL
Gene Name FBP1
Gene Alias FBP
Gene Description fructose-1,6-bisphosphatase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (1.25 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human FBP1.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 2203

Enviar uma mensagem


FBP1 polyclonal antibody

FBP1 polyclonal antibody