EYA3 polyclonal antibody
  • EYA3 polyclonal antibody

EYA3 polyclonal antibody

Ref: AB-PAB30062
EYA3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human EYA3.
Información adicional
Size 100 uL
Gene Name EYA3
Gene Alias DKFZp686C132
Gene Description eyes absent homolog 3 (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq QSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIIIFHSLLTGSYA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.05-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to internal region of human EYA3.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 2140

Enviar uma mensagem


EYA3 polyclonal antibody

EYA3 polyclonal antibody