EXOSC3 polyclonal antibody
  • EXOSC3 polyclonal antibody

EXOSC3 polyclonal antibody

Ref: AB-PAB30057
EXOSC3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human EXOSC3.
Información adicional
Size 100 uL
Gene Name EXOSC3
Gene Alias CGI-102|MGC15120|MGC723|RP11-3J10.8|RRP40|Rrp40p|bA3J10.7|hRrp40p|p10
Gene Description exosome component 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq TKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to internal region of human EXOSC3.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 51010

Enviar uma mensagem


EXOSC3 polyclonal antibody

EXOSC3 polyclonal antibody