ERCC8 polyclonal antibody
  • ERCC8 polyclonal antibody

ERCC8 polyclonal antibody

Ref: AB-PAB30053
ERCC8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human ERCC8.
Información adicional
Size 100 uL
Gene Name ERCC8
Gene Alias CKN1|CSA
Gene Description excision repair cross-complementing rodent repair deficiency, complementation group 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,IHC-P
Immunogen Prot. Seq QELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to C-terminus of human ERCC8.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 1161

Enviar uma mensagem


ERCC8 polyclonal antibody

ERCC8 polyclonal antibody