ENO3 polyclonal antibody
  • ENO3 polyclonal antibody

ENO3 polyclonal antibody

Ref: AB-PAB30051
ENO3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human ENO3.
Información adicional
Size 100 uL
Gene Name ENO3
Gene Alias MSE
Gene Description enolase 3 (beta, muscle)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELR
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (5 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human ENO3.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 2027

Enviar uma mensagem


ENO3 polyclonal antibody

ENO3 polyclonal antibody