EIF3M polyclonal antibody
  • EIF3M polyclonal antibody

EIF3M polyclonal antibody

Ref: AB-PAB30047
EIF3M polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human EIF3M.
Información adicional
Size 100 uL
Gene Name EIF3M
Gene Alias B5|FLJ29030|GA17|PCID1|hfl-B5
Gene Description eukaryotic translation initiation factor 3, subunit M
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human EIF3M.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 10480

Enviar uma mensagem


EIF3M polyclonal antibody

EIF3M polyclonal antibody