DLX2 polyclonal antibody
  • DLX2 polyclonal antibody

DLX2 polyclonal antibody

Ref: AB-PAB30034
DLX2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human DLX2.
Información adicional
Size 100 uL
Gene Name DLX2
Gene Alias TES-1|TES1
Gene Description distal-less homeobox 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,IHC-P
Immunogen Prot. Seq MTGVFDSLVADMHSTQIAASSTYHQHQQPPSGGGAGPGGNSSSSSSLHKP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human DLX2.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 1746

Enviar uma mensagem


DLX2 polyclonal antibody

DLX2 polyclonal antibody