CHST4 polyclonal antibody
  • CHST4 polyclonal antibody

CHST4 polyclonal antibody

Ref: AB-PAB29998
CHST4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human CHST4.
Información adicional
Size 100 uL
Gene Name CHST4
Gene Alias LSST
Gene Description carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq CSQQPFEVVEKACRSYSHVVLKEVRFFNLQSLYPLLKDPSLNLHIVHLVR
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (1.25 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to internal region of human CHST4.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 10164

Enviar uma mensagem


CHST4 polyclonal antibody

CHST4 polyclonal antibody