CCRN4L polyclonal antibody
  • CCRN4L polyclonal antibody

CCRN4L polyclonal antibody

Ref: AB-PAB29991
CCRN4L polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human CCRN4L.
Información adicional
Size 100 uL
Gene Name CCRN4L
Gene Alias CCR4L|MGC142054|MGC142060|MGC4120817|MGC78549|NOC
Gene Description CCR4 carbon catabolite repression 4-like (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq LNSSAASQHPEYLVSPDPEHLEPIDPKELLEECRAVLHTRPPRFQRDFVD
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (1-2 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human CCRN4L.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 25819

Enviar uma mensagem


CCRN4L polyclonal antibody

CCRN4L polyclonal antibody