CATSPER2 polyclonal antibody
  • CATSPER2 polyclonal antibody

CATSPER2 polyclonal antibody

Ref: AB-PAB29987
CATSPER2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human CATSPER2.
Información adicional
Size 100 uL
Gene Name CATSPER2
Gene Alias MGC33346
Gene Description cation channel, sperm associated 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (1.25 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human CATSPER2.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 117155

Enviar uma mensagem


CATSPER2 polyclonal antibody

CATSPER2 polyclonal antibody