C4BPB polyclonal antibody
  • C4BPB polyclonal antibody

C4BPB polyclonal antibody

Ref: AB-PAB29985
C4BPB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human C4BPB.
Información adicional
Size 100 uL
Gene Name C4BPB
Gene Alias C4BP
Gene Description complement component 4 binding protein, beta
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,IHC-P
Immunogen Prot. Seq CCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human C4BPB.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 725

Enviar uma mensagem


C4BPB polyclonal antibody

C4BPB polyclonal antibody