AUH polyclonal antibody
  • AUH polyclonal antibody

AUH polyclonal antibody

Ref: AB-PAB29976
AUH polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human AUH.
Información adicional
Size 100 uL
Gene Name AUH
Gene Alias -
Gene Description AU RNA binding protein/enoyl-Coenzyme A hydratase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq IGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLARE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to C-terminus of human AUH.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 549

Enviar uma mensagem


AUH polyclonal antibody

AUH polyclonal antibody