View larger
Rabbit polyclonal antibody raised against synthetic peptide of human ASGR2.
AB-PAB29969
New product
ASGR2 polyclonal antibody
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Data sheet
| Size | 100 uL |
| Gene Name | ASGR2 |
| Gene Alias | ASGP-R|CLEC4H2|Hs.1259|L-H2 |
| Gene Description | asialoglycoprotein receptor 2 |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,IHC-P |
| Immunogen Prot. Seq | STLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPV |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)<br>Western Blot (1 ug/mL)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | A synthetic peptide corresponding to N-terminus of human ASGR2. |
| Storage Buffer | In PBS (2% sucrose, 0.09% sodium azide). |
| Gene ID | 433 |
More info
Rabbit polyclonal antibody raised against synthetic peptide of human ASGR2.