ASGR2 polyclonal antibody
  • ASGR2 polyclonal antibody

ASGR2 polyclonal antibody

Ref: AB-PAB29969
ASGR2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human ASGR2.
Información adicional
Size 100 uL
Gene Name ASGR2
Gene Alias ASGP-R|CLEC4H2|Hs.1259|L-H2
Gene Description asialoglycoprotein receptor 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq STLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human ASGR2.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 433

Enviar uma mensagem


ASGR2 polyclonal antibody

ASGR2 polyclonal antibody