APOBEC3G polyclonal antibody
  • APOBEC3G polyclonal antibody

APOBEC3G polyclonal antibody

Ref: AB-PAB29968
APOBEC3G polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human APOBEC3G.
Información adicional
Size 100 uL
Gene Name APOBEC3G
Gene Alias ARP9|CEM15|FLJ12740|MDS019|bK150C2.7|dJ494G10.1
Gene Description apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC
Form Liquid
Recomended Dilution Immunofluorescence (1:100)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human APOBEC3G.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 60489

Enviar uma mensagem


APOBEC3G polyclonal antibody

APOBEC3G polyclonal antibody