ARMCX6 polyclonal antibody
  • ARMCX6 polyclonal antibody

ARMCX6 polyclonal antibody

Ref: AB-PAB29966
ARMCX6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human ARMCX6.
Información adicional
Size 100 uL
Gene Name ARMCX6
Gene Alias FLJ20811
Gene Description armadillo repeat containing, X-linked 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq TMARPWTEDGDWTEPGAPGGTEDRPSGGGKANRAHPIKQRPFPYEHKNTW
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (5 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human ARMCX6.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 54470

Enviar uma mensagem


ARMCX6 polyclonal antibody

ARMCX6 polyclonal antibody