ABT1 polyclonal antibody
  • ABT1 polyclonal antibody

ABT1 polyclonal antibody

Ref: AB-PAB29949
ABT1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human ABT1.
Información adicional
Size 100 uL
Gene Name ABT1
Gene Alias hABT1
Gene Description activator of basal transcription 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,IHC-P
Immunogen Prot. Seq EVAQAKRETDFYLQSVERGQRFLAADGDPARPDGSWTFAQRPTEQELRAR
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (4-8 ug/mL)
Western Blot (1.25 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to internal region of human ABT1.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 29777

Enviar uma mensagem


ABT1 polyclonal antibody

ABT1 polyclonal antibody