STOM polyclonal antibody
  • STOM polyclonal antibody

STOM polyclonal antibody

Ref: AB-PAB29945
STOM polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human STOM.
Información adicional
Size 100 uL
Gene Name STOM
Gene Alias BND7|EPB7|EPB72
Gene Description stomatin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IF
Immunogen Prot. Seq LQRAMAAEAEASREARAKVIAAEGEMNASRALKEASMVITESPAALQLRY
Form Liquid
Recomended Dilution Immunofluorescence (1:150)
Western Blot (1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to C-terminus of human STOM.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 2040

Enviar uma mensagem


STOM polyclonal antibody

STOM polyclonal antibody