CDYL polyclonal antibody
  • CDYL polyclonal antibody

CDYL polyclonal antibody

Ref: AB-PAB29937
CDYL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human CDYL.
Información adicional
Size 100 uL
Gene Name CDYL
Gene Alias CDYL1|DKFZp586C1622|MGC131936
Gene Description chromodomain protein, Y-like
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNSNFSKTSPKALV
Form Liquid
Recomended Dilution Immunofluorescence (4 ug/mL)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to N-terminus of human CDYL.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 9425

Enviar uma mensagem


CDYL polyclonal antibody

CDYL polyclonal antibody