CSF1 polyclonal antibody
  • CSF1 polyclonal antibody

CSF1 polyclonal antibody

Ref: AB-PAB29929
CSF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against synthetic peptide of human CSF1.
Información adicional
Size 100 uL
Gene Name CSF1
Gene Alias MCSF|MGC31930
Gene Description colony stimulating factor 1 (macrophage)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq MAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPP
Form Liquid
Recomended Dilution Immunofluorescence (10 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Western Blot (0.2-1 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to internal region of human CSF1.
Storage Buffer In PBS (2% sucrose, 0.09% sodium azide).
Gene ID 1435

Enviar uma mensagem


CSF1 polyclonal antibody

CSF1 polyclonal antibody