MCM7 polyclonal antibody
  • MCM7 polyclonal antibody

MCM7 polyclonal antibody

Ref: AB-PAB29923
MCM7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial synthetic protein of human MCM7.
Información adicional
Size 100 uL
Gene Name MCM7
Gene Alias CDABP0042|CDC47|MCM2|P1.1-MCM3|P1CDC47|P85MCM|PNAS-146
Gene Description minichromosome maintenance complex component 7
Storage Conditions Store at 4C for up to one week. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq HRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDV
Form Liquid
Recomended Dilution Immunohistochemistry (1:250)
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to amino acids 301-350 of human MBNL1.
Storage Buffer In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide).
Gene ID 4176
Iso type IgG

Enviar uma mensagem


MCM7 polyclonal antibody

MCM7 polyclonal antibody