MCM3 polyclonal antibody View larger

Rabbit polyclonal antibody raised against partial synthetic protein of human MCM3.

AB-PAB29920

New product

MCM3 polyclonal antibody

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.


Data sheet

Size 100 uL
Gene Name MCM3
Gene Alias HCC5|MGC1157|P1-MCM3|P1.h|RLFB
Gene Description minichromosome maintenance complex component 3
Storage Conditions Store at 4ºC for up to one week. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq SQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVHTPKTADSQE
Form Liquid
Recomended Dilution Immunohistochemistry (1:250)<br>Western Blot (1:1000)<br>The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to amino acids 726-775 of human MCM3.
Storage Buffer In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide).
Gene ID 4172
Iso type IgG

More info

Rabbit polyclonal antibody raised against partial synthetic protein of human MCM3.

Enviar uma mensagem

Rabbit polyclonal antibody raised against partial synthetic protein of human MCM3.

Rabbit polyclonal antibody raised against partial synthetic protein of human MCM3.