MIF4GD polyclonal antibody
  • MIF4GD polyclonal antibody

MIF4GD polyclonal antibody

Ref: AB-PAB29912
MIF4GD polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial synthetic protein of human MIF4GD.
Información adicional
Size 100 uL
Gene Name MIF4GD
Gene Alias AD023|MGC45027|MIFD|SLIP1
Gene Description MIF4G domain containing
Storage Conditions Store at 4C for up to one week. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq LFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD
Form Liquid
Recomended Dilution Immunohistochemistry (1:250)
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to amino acids 207-256 of human MIF4GD.
Storage Buffer In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide).
Gene ID 57409
Iso type IgG

Enviar uma mensagem


MIF4GD polyclonal antibody

MIF4GD polyclonal antibody