AB-PAB29905
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Size | 100 uL |
Gene Name | LHX3 |
Gene Alias | DKFZp762A2013|LIM3|M2-LHX3 |
Gene Description | LIM homeobox 3 |
Storage Conditions | Store at 4ºC for up to one week. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Ce,IHC-P |
Immunogen Prot. Seq | QNRRAKEKRLKKDAGRQRWGQYFRNMKRSRGGSKSDKDSVQEGQDSDAEV |
Form | Liquid |
Recomended Dilution | Immunohistochemistry (1:250)<br>Western Blot (1:1000)<br>The optimal working dilution should be determined by the end user. |
Antigen species Target species | Human |
Immunogen | A synthetic peptide corresponding to 50 amino acids at the internal region of human LHX3. |
Storage Buffer | In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide). |
Gene ID | 8022 |
Iso type | IgG |