KHDRBS3 polyclonal antibody
  • KHDRBS3 polyclonal antibody

KHDRBS3 polyclonal antibody

Ref: AB-PAB29889
KHDRBS3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial synthetic protein of human KHDRBS3.
Información adicional
Size 100 uL
Gene Name KHDRBS3
Gene Alias Etle|SALP|SLM-2|SLM2|T-STAR|TSTAR|etoile
Gene Description KH domain containing, RNA binding, signal transduction associated 3
Storage Conditions Store at 4C for up to one week. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq EQSYDSYDNSYSTPAQSGADYYDYGHGLSEETYDSYGQEEWTNSRHKAPS
Form Liquid
Recomended Dilution Immunohistochemistry (1:250)
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to amino acids 281-330 of human KHDRBS3.
Storage Buffer In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide).
Gene ID 10656
Iso type IgG

Enviar uma mensagem


KHDRBS3 polyclonal antibody

KHDRBS3 polyclonal antibody