KCTD6 polyclonal antibody
  • KCTD6 polyclonal antibody

KCTD6 polyclonal antibody

Ref: AB-PAB29888
KCTD6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial synthetic protein of human KCTD6.
Información adicional
Size 100 uL
Gene Name KCTD6
Gene Alias MGC27385
Gene Description potassium channel tetramerisation domain containing 6
Storage Conditions Store at 4C for up to one week. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq HLYTTSLTTLTRYPDSMLGAMFGGDFPTTRDPQGNYFINRDGPLFRYVLN
Form Liquid
Recomended Dilution Immunohistochemistry (1:250)
Western Blot (1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen A synthetic peptide corresponding to amino acids 32-70 of human KCTD6.
Storage Buffer In 1X PBS , pH 7.4 (2% sucrose, 0.09% sodium azide).
Gene ID 200845
Iso type IgG

Enviar uma mensagem


KCTD6 polyclonal antibody

KCTD6 polyclonal antibody